| Name | Active human Neurotrophin 4 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200241 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 2 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. Purity: >97% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. Determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20-50 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P34130 |
| Gene | NTF4 |
| Residue | 81 to 210 |
| Sequence | GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGS PLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL TADAQGRVGWRWIRIDTACVCTLLSRTGRA |
| Supplier Page | Shop |