| Name | Active human NRG4 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191709 |
| Category | Protein |
| Prices | $359.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3.0 ng/mL, corresponding to a specific activity of 3.0 x 10 5 Units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q8WWG1 |
| Gene | NRG4 |
| Residue | 1 to 61 |
| Sequence | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFL PGSSIQTKSNL |
| Supplier Page | Shop |