Human MCP3 full length protein

Name Human MCP3 full length protein
Supplier Abcam
Catalog ab152056
Category Protein
Applications SDS-PAGE HPLC
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P80098
Gene CCL7
Residue 24 to 99
Sequence QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKE ICADPTQKWVQDFMKHLDKKTQTPKLVDHHHHHH
Supplier Page Shop