Active human Parathyroid Hormone full length protein

• Supplier: Abcam
• Catalog: ab201365
• Category: Protein
• Prices: $107.00
• Sizes: 5 µg
• Applications: FA HPLC SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC analysis.
• Bioactivity: Fully biologically active when compared to standard. The ED 50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10 4 IU/mg.
• SwissProt/Accession: P01270
• Gene: PTH
• Residue: 32 to 115
• Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQR PRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ