| Name | MT1X Recombinant Protein (Human) (OPCA04111) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA04111 |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Tag/Conjugation | N-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P80297 |
| Gene | MT1X |
| Sequence | Partial: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC |
| Description | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids |
| Supplier Page | Shop |