MDC1 Recombinant Protein (Human) (OPCA04285)

Name MDC1 Recombinant Protein (Human) (OPCA04285)
Supplier Aviva Systems Biology
Catalog OPCA04285
Category Protein
Species Reactivities Human
Nature Recombinant
Tag/Conjugation N-terminal 6xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q14676
Gene MDC1
Sequence Partial: APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Description Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle
Supplier Page Shop