MTIF3 Recombinant Protein (Human) (OPCA05019)

Name MTIF3 Recombinant Protein (Human) (OPCA05019)
Supplier Aviva Systems Biology
Catalog OPCA05019
Category Protein
Species Reactivities Human
Nature Recombinant
Tag/Conjugation N-terminal GST-tagged
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9H2K0
Gene MTIF3
Sequence Full Length : TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Description IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
Supplier Page Shop