Recombinant Human Leukocyte-specific transcript 1 protein(LST1)

Name Recombinant Human Leukocyte-specific transcript 1 protein(LST1)
Supplier Cusabio
Catalog CSB-EP013217HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation N-terminal 6xHis-tagged $("#dvInfo").change(f
Purity Greater than 85% as determined by SDS-PAGE.
SwissProt/Accession O00453
Gene LST1
Residue 1-66aa
Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
Description Full Length of Isoform 10
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.