Recombinant Human Leukocyte-specific transcript 1 protein(LST1),Mammalian cell

Name Recombinant Human Leukocyte-specific transcript 1 protein(LST1),Mammalian cell
Supplier Cusabio
Catalog CSB-MP013217HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source Mammalian cell
Tag/Conjugation N-terminal His-tagged and C-terminal Myc-tagg
Purity >85% (SDS-PAGE)
SwissProt/Accession O00453
Gene LST1
Residue 1-66
Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
Description Full Length of Isoform 10
Supplier Page Shop