Calpain 13 Recombinant Protein Antigen

Name Calpain 13 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56669PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CAPN13
Sequence DGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGNTAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Calpain 13
Supplier Page Shop