beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen

Name beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58906PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene B4GALT2
Sequence PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human beta-1,4-Galactosyltransferase 2/B4GalT2
Supplier Page Shop