BACH2 Recombinant Protein Antigen

Name BACH2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58464PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody BACH2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene BACH2
Sequence SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BACH2
Supplier Page Shop