C9orf23 Recombinant Protein Antigen

Name C9orf23 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56025PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RPP25L
Sequence MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C9orf23
Supplier Page Shop