G6b/C6orf25 Recombinant Protein Antigen

Name G6b/C6orf25 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-57672PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody G6b/C6orf25 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C6orf25
Sequence DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human G6b/C6orf25
Supplier Page Shop