ZNF136 Recombinant Protein Antigen

Name ZNF136 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58400PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF136 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF136
Sequence ECGKAYSCRASFQRHMLTHAEDGPPYKCMWE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF136
Supplier Page Shop