Recombinant Human V-Set and Transmembrane Domain-Containing 1,VSTM1 (C-6His)

Name Recombinant Human V-Set and Transmembrane Domain-Containing 1,VSTM1 (C-6His)
Supplier Signalway Antibody
Catalog AP76109
Category Protein
Prices $279.00, $579.00, $2,289.00, $3,209.00
Sizes 10 µg, 50 µg, 500 µg, 1 mg
Species Reactivities Human
Nature Recombinant
Source Human Cells
Endotoxin Less than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
Gene VSTM1
Sequence YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTVDHHHHHH
Supplier Page Shop