Name | KCNK2 fusion protein |
---|---|
Supplier | Proteintech Group |
Catalog | Ag25209 |
Category | Protein |
Species Reactivities | Human |
Source | E. coli -derived, PGEX-4T |
Tag/Conjugation | GST |
Purity | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Bioactivity | Not tested. |
Endotoxin | Please contact the lab for more information. |
Gene | KCNK2 |
Sequence | PRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVV (18-55 aa encoded by BC101693 ) |
Supplier Page | Shop |