Human Myosin light chain 3 protein fragment
| Name | Human Myosin light chain 3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab158938 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P08590 |
| Gene | MYL3 |
| Residue | 34 to 106 |
| Sequence | EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRAL GQNPTQAEVLRVLGKPRQEELNT |
| Supplier Page | Shop |
Product images
ab158938 on a 12.5% SDS-PAGE stained with Coomassie Blue.