| Name | Active human PDGF AA full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191656 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the dose-dependent stimulation of thymidine uptake by Balb/c 3T3 cells is ≤ 1.0 ng/mL, corresponding to a specific activity of > 1.0 x 10 6 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04085 |
| Gene | PDGFA |
| Residue | 87 to 211 |
| Sequence | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTS SVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNP DYREEDTGRPRESGKKRKRKRLKPT |
| Supplier Page | Shop |