| Name | Recombinant Human BTNL9 protein, His-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | BTNL9-49H |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK293 |
| Tag/Conjugation | His |
| Purity | Greater than 90% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| SwissProt/Accession | Q6UXG8 |
| Gene | BTNL9 |
| Sequence | EVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFR NRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSHHHHHH |
| Description | Recombinant Human Butyrophilin-like Protein 9 is produced by our Mammalian expression system and the target gene encoding Glu48-Ser160 is expressed with a 6His tag at the C-terminus. |
| Supplier Page | Shop |