Recombinant human C1QC protein, His/GST-tagged

• Supplier: Creative Biomart
• Catalog: C1QC-927H
• Category: Protein
• Applications: SDS-PAGE WB
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Tag/Conjugation: His/GST
• Purity: > 95%
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• SwissProt/Accession: P02747
• Gene: C1QC
• Sequence: KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
• Description: Recombinant C1QC protein(Lys117-Asp245), fused to His/GST-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.