Recombinant Human GSPT1 protein, GST-tagged

Name Recombinant Human GSPT1 protein, GST-tagged
Supplier Creative Biomart
Catalog GSPT1-940H
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation GST
Purity 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
SwissProt/Accession P15170
Gene GSPT1
Sequence FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Description Recombinant Human GSPT1 protein (294-499 aa) was fused to GST-tag and expressed in E.coli.
Supplier Page Shop