Human Natriuretic Peptide Receptor B protein fragment
| Name | Human Natriuretic Peptide Receptor B protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114435 |
| Category | Peptide |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P20594 |
| Gene | NPR2 |
| Residue | 131 to 230 |
| Sequence | AKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPL |
| Supplier Page | Shop |
Product images
ab114435 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.