Recombinant Rhesus monkey IL10 protein, His-tagged

• Supplier: Creative Biomart
• Catalog: IL10-20R
• Category: Protein
• Applications: SDS-PAGE WB
• Species Reactivities: Monkey
• Nature: Recombinant
• Source: E.coli
• Tag/Conjugation: His
• Purity: > 90 %, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Gene: IL10
• Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
• Description: Recombinant Rhesus monkey IL10 protein is produced by E.coli expression system and is fused with a His tag at the N-terminal.