Human Natriuretic Peptide Receptor C protein fragment
| Name | Human Natriuretic Peptide Receptor C protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114355 |
| Category | Peptide |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P17342 |
| Gene | NPR3 |
| Residue | 42 to 140 |
| Sequence | RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRR LLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA |
| Supplier Page | Shop |
Product images
ab114355 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.