| Name | Recombinant human NAT9 protein, His-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | NAT9-1195H |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Tag/Conjugation | His |
| Purity | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining |
| SwissProt/Accession | Q9BTE0 |
| Gene | NAT9 |
| Sequence | MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC |
| Description | Recombinant NAT9 protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques. |
| Supplier Page | Shop |