Recombinant Human SIGLEC15 protein, His-SUMO-tagged

• Supplier: Creative Biomart
• Catalog: SIGLEC15-10H
• Category: Protein
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Tag/Conjugation: His-SUMO
• Purity: Greater than 90 % as determined by SDS-PAGE.
• Endotoxin: ﹤1.0 EU per 1μg cytokine as determined by the LAL method.
• SwissProt/Accession: Q6ZMC9
• Gene: SIGLEC15
• Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
• Description: Recombinant Human SIGLEC15 protein is produced by E.coli expression system and fused with a 6×His-SUMO tag at the N-terminal