Recombinant Human TRIM47 protein partial ORF, GST-tagged

Name Recombinant Human TRIM47 protein partial ORF, GST-tagged
Supplier Creative Biomart
Catalog TRIM47-1401H
Category Protein
Applications ELISA WB Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Tag/Conjugation GST
SwissProt/Accession Q96LD4
Gene TRIM47
Sequence PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Description Recombinant Human TRIM47 protein partial ORF (539a.a.-638a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow.
Supplier Page Shop