Recombinant E.coli Beta-lactamase protein

Name Recombinant E.coli Beta-lactamase protein
Supplier Creative Biomart
Catalog TEM-1-8922H
Category Protein
Species Reactivities Escherichia coli
Nature Recombinant
Source E.coli
Purity >95% by SDS-PAGE.
Bioactivity Fully biologically active when compared to standard. One unit of enzyme activity is defined as the amount of enzyme which will hydrolyze 1.0 μmol of benzyl penicillin in presence of EDTA at pH 7.0 and at 25 centigrade.
SwissProt/Accession P62593
Gene TEM-1
Sequence MHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Description Recombinant E.coli Beta-lactamase protein was expressed in E.coli.
Supplier Page Shop