| Name | Recombinant Human ZBTB9 Protein, HIS-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | ZBTB9-088H |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | HIS |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Endotoxin | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| SwissProt/Accession | Q96C00 |
| Gene | ZBTB9 |
| Sequence | METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGPHPLPM |
| Description | Recombinant Human ZBTB9 fused with His tag at C-termina was expressed in E. coli. |
| Supplier Page | Shop |