Recombinant Human ZNRF1 Protein, His-tagged

• Supplier: Creative Biomart
• Catalog: ZNRF1-443H
• Category: Protein
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Tag/Conjugation: His
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• SwissProt/Accession: Q8ND25
• Gene: ZNRF1
• Sequence: MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH
• Description: Recombinant Human ZNRF1 fused with His tag at N, C-terminal was expressed in E. coli.