Recombinant Human ZNRF1 Protein, His-tagged

Name Recombinant Human ZNRF1 Protein, His-tagged
Supplier Creative Biomart
Catalog ZNRF1-443H
Category Protein
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
SwissProt/Accession Q8ND25
Gene ZNRF1
Sequence MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH
Description Recombinant Human ZNRF1 fused with His tag at N, C-terminal was expressed in E. coli.
Supplier Page Shop