Human NDUFA1 full length protein
| Name | Human NDUFA1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab158959 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | O15239 |
| Gene | NDUFA1 |
| Residue | 24 to 70 |
| Sequence | AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
| Supplier Page | Shop |
Product images
ab158959 on a 12.5% SDS-PAGE stained with Coomassie Blue.