Human NDUFV3 full length protein
| Name | Human NDUFV3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab171680 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 85 % by SDS-PAGE. ab171680 was purified using conventional chromatography techniques. |
| SwissProt/Accession | P56181 |
| Gene | NDUFV3 |
| Residue | 35 to 108 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSSAESGKSEKGQPQNSKKQSPPKKPAPV PAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab171680 (3µg).