Active human Peroxiredoxin 2 full length protein
| Name | Active human Peroxiredoxin 2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167977 |
| Category | Protein |
| Prices | $465.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Specific activity: approximately 200-230 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute. |
| SwissProt/Accession | P32119 |
| Gene | PRDX2 |
| Residue | 1 to 198 |
| Sequence | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFV CPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN IPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGR SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Supplier Page | Shop |
Product images
15% SDS PAGE of ab167977 (3µg).