Human Neuropeptide Y full length protein
| Name | Human Neuropeptide Y full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab112331 |
| Category | Protein |
| Applications | SDS-PAGE ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P01303 |
| Gene | NPY |
| Residue | 1 to 97 |
| Sequence | MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYS ALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
| Supplier Page | Shop |
Product images
ab112331 run on a 12.5% SDS-PAGE Stained with Coomassie Blue.