Active human Peroxiredoxin 6-SO3 full length protein
| Name | Active human Peroxiredoxin 6-SO3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167982 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Specific activity: approximately 95-120 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX 6 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute. |
| SwissProt/Accession | P30041 |
| Gene | PRDX6 |
| Residue | 1 to 224 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMPGGLLLGDVAPNFEANTTVGRIRFHDFLG DSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL AWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVT ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
| Supplier Page | Shop |
Product images
15% SDS PAGE analysis of ab167982 at 3 µg.