Human Nicotinic Acetylcholine Receptor beta 3 protein fragment
| Name | Human Nicotinic Acetylcholine Receptor beta 3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab158119 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| Gene | CHRNB3 |
| Residue | 128 to 223 |
| Sequence | SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYD GTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI |
| Supplier Page | Shop |
Product images
ab158119 on a 12.5% SDS-PAGE stained with Coomassie Blue.