Human NKF3 kinase family member protein fragment
| Name | Human NKF3 kinase family member protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab164128 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9H792 |
| Gene | PEAK1 |
| Residue | 1151 to 1250 |
| Sequence | TPPPLPKKMIIRANTEPISKDLQKSMESSLCVMANPTYDIDPNWDASSAG SSISYELKGLDIESYDSLERPLRKERPVPSAANSISSLTTLSIKDRFSNS |
| Supplier Page | Shop |
Product images
ab164128 on a 12.5% SDS-PAGE stained with Coomassie Blue.