Human NKX2.8 protein fragment
| Name | Human NKX2.8 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab161945 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | O15522 |
| Gene | NKX2-8 |
| Residue | 3 to 50 |
| Sequence | TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH |
| Supplier Page | Shop |
Product images
ab161945 on a 12.5% SDS-PAGE stained with Coomassie Blue.