Human Nuclear Factor Erythroid 2 Related Factor 1 protein fragment
| Name | Human Nuclear Factor Erythroid 2 Related Factor 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab152570 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q14494 |
| Gene | NFE2L1 |
| Residue | 677 to 771 |
| Sequence | DTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLR DENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab152570 stained with Coomassie Blue.