Human Nuclear Receptor Corepressor NCoR protein fragment
| Name | Human Nuclear Receptor Corepressor NCoR protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab153002 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | O75376 |
| Gene | NCOR1 |
| Residue | 2341 to 2440 |
| Sequence | GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTM RMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD |
| Supplier Page | Shop |
Product images
ab153002 on a 12.5% SDS-PAGE stained with Coomassie Blue.