Human Nucleoside Diphosphate Kinase 7 protein fragment
| Name | Human Nucleoside Diphosphate Kinase 7 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab162264 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9Y5B8 |
| Gene | NME7 |
| Residue | 277 to 374 |
| Sequence | DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCG PADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL |
| Supplier Page | Shop |
Product images
ab162264 on a 12.5% SDS-PAGE stained with Coomassie Blue.