Active human PLA2G1B full length protein
| Name | Active human PLA2G1B full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191680 |
| Category | Protein |
| Prices | $649.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to hydrolyze 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphoglycerol. The specific activity is >2,500 pmol/min/µg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04054 |
| Gene | PLA2G1B |
| Residue | 23 to 148 |
| Sequence | AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDN CYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDR NAAICFSKAPYNKAHKNLDTKKYCQS |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab191680 stained overnight with Coomassie Blue. DTT-reduced protein migrates at 19 kDa in SDS-PAGE.