Human Osteocalcin full length protein
| Name | Human Osteocalcin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab152232 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P02818 |
| Gene | BGLAP |
| Residue | 52 to 100 |
| Sequence | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab152232 stained with Coomassie Blue.