Active human PPIL3 full length protein

Name Active human PPIL3 full length protein
Supplier Abcam
Catalog ab113119
Category Protein
Prices $302.00
Sizes 100 µg
Applications MS FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity > 90 % by SDS-PAGE. ab113119 was purified using conventional chromatography.
Bioactivity Specific activity is > 280 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin. Activity Assay Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin. Add 10 µl of recombinant PPIL3 protein with 1 µg in assay buffer. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM) Record the increase in A405 nm for 30 minutes at 25°C.
SwissProt/Accession Q9H2H8
Gene PPIL3
Residue 1 to 161
Sequence MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCERTPKTCENFLA LCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDE LEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Supplier Page Shop

Product images