Human Pancreatic Polypeptide full length protein

Name Human Pancreatic Polypeptide full length protein
Supplier Abcam
Catalog ab194031
Category Protein
Applications HPLC SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P01298
Gene PPY
Residue 30 to 88
Sequence APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEW GSPHAAVPRVDHHHHHH
Supplier Page Shop