| Name | Active human Pro-neuregulin-1, membrane-bound isoform protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab192084 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED(50) was determined by the dose-dependent proliferation of human MCF-7 cells was found to be < 0.3 ng/mL, corresponding to a specific activity of 2.0 x 10 6 Units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q02297 |
| Gene | NRG1 |
| Residue | 177 to 241 |
| Sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVM ASFYKHLGIEFMEAE |
| Supplier Page | Shop |