Human PER2 protein fragment
| Name | Human PER2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112382 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | Useful for Antibody Production and Protein Array |
| SwissProt/Accession | O15055 |
| Gene | PER2 |
| Residue | 1 to 100 |
| Sequence | MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTG RDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD |
| Supplier Page | Shop |
Product images
ab112382 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.