Human PHD finger protein 6 protein fragment
| Name | Human PHD finger protein 6 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab164561 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q8IWS0 |
| Gene | PHF6 |
| Residue | 1 to 99 |
| Sequence | MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSS ALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTC |
| Supplier Page | Shop |
Product images
ab164561 on a 12.5% SDS-PAGE stained with Coomassie Blue.