Human Phospholipase A2 activator protein (PLAP) protein fragment
| Name | Human Phospholipase A2 activator protein (PLAP) protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab160457 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9Y263 |
| Gene | PLAA |
| Residue | 639 to 738 |
| Sequence | KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRL LVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL |
| Supplier Page | Shop |
Product images
ab160457 on a 12.5% SDS-PAGE stained with Coomassie Blue.